PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0352409.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 299aa    MW: 34667.4 Da    PI: 8.6703
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0352409.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.67.2e-51231502128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                       pGfrFhPtdeelv +yLk+kv +k+l++ + ik+vdiyk++PwdLp+  + ++kewyfF+kr +ky+++ r+nr+tksg+Wkatg dk ++s 
  Lj0g3v0352409.2  23 LPGFRFHPTDEELVGFYLKRKVGKKPLRI-DLIKQVDIYKYDPWDLPM-NSVGDKEWYFFCKRGRKYRNSIRPNRVTKSGFWKATGIDKVIYSV 114
                      69***************************.99***************4.34589*************************************998 PP

              NAM  96 ...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  Lj0g3v0352409.2 115 kepHHQSIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 150
                      7888889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5415177IPR003441NAC domain
PROSITE profilePS5100553.37322178IPR003441NAC domain
PfamPF023653.8E-2624150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDVVQLHTLS ETDDKMKEEE VVLPGFRFHP TDEELVGFYL KRKVGKKPLR IDLIKQVDIY  60
KYDPWDLPMN SVGDKEWYFF CKRGRKYRNS IRPNRVTKSG FWKATGIDKV IYSVKEPHHQ  120
SIGLKKSLVY YRGSAGKGTK TDWMMHEFRL PPNNPHDANA SNDVQEAEVW TLCRIFKRIT  180
PYKKYTPNLK DSAADTKPNP ETSIDSDNCK SFMQQVEMKP IFGFVDQNKQ LLLGQFGSVA  240
LPGVPSTLPY PSSWNQNIVE DTIFANQNWD DLRSAIQFAN DPSKVYDNFI ETYIPPYFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-482418419171NO APICAL MERISTEM PROTEIN
1ut4_B3e-482418419171NO APICAL MERISTEM PROTEIN
1ut7_A3e-482418419171NO APICAL MERISTEM PROTEIN
1ut7_B3e-482418419171NO APICAL MERISTEM PROTEIN
3swm_A4e-482418422174NAC domain-containing protein 19
3swm_B4e-482418422174NAC domain-containing protein 19
3swm_C4e-482418422174NAC domain-containing protein 19
3swm_D4e-482418422174NAC domain-containing protein 19
3swp_A4e-482418422174NAC domain-containing protein 19
3swp_B4e-482418422174NAC domain-containing protein 19
3swp_C4e-482418422174NAC domain-containing protein 19
3swp_D4e-482418422174NAC domain-containing protein 19
4dul_A3e-482418419171NAC domain-containing protein 19
4dul_B3e-482418419171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551931.11e-151PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK555e-83NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A0R0EYY21e-151A0A0R0EYY2_SOYBN; Uncharacterized protein
STRINGGLYMA18G13574.11e-151(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.13e-84NAC domain containing protein 42